Antibodies

Jump to Filters
View as table Download
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA350095

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGA2B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGA2B
CD168 (HMMR) (C-term) Rabbit Polyclonal Antibody
AP52063PU-N

USD 580.00

2 Weeks

CD168 (HMMR) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 675-705 amino acids from the C-terminal region of human CD168 / HMMR
CD36 Rabbit Polyclonal Antibody
TA301400

USD 620.00

2 Weeks

Rabbit Polyclonal Antibody against CD36

Applications ICC/IF, IHC, WB
Reactivities Human, Bovine, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 100-200.
Thrombospondin 1 (THBS1) Goat Polyclonal Antibody
TA326718

USD 520.00

5 Days

Goat Anti-THBS1 Antibody

Applications FC, IF, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence NRIPESGGDNSVFD-C, from the N Terminus of the protein sequence according to NP_003237.2.
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA350748

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA2
Collagen V (COL5A1) Rabbit Polyclonal Antibody
R1042

USD 780.00

3 Days

Collagen V (COL5A1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Unconjugated
Immunogen Collagen type V purified from Human and Bovine placenta
Collagen III (COL3A1) Rabbit Polyclonal Antibody
TA308777

USD 625.00

In Stock

Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Chicken, Rat, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1
CD61 (ITGB3) Rabbit Polyclonal Antibody
TA349357

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3
CD36 Rabbit Polyclonal Antibody
TA301401

USD 550.00

5 Days

Rabbit Polyclonal Antibody against CD36

Applications FC, ICC/IF, IHC, Immunoblotting, SDS-PAGE, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide mapping to a region of human CD36 between residues 300-400.
Collagen I (COL1A2) Rabbit Polyclonal Antibody
TA313648

USD 380.00

In Stock

Rabbit polyclonal Collagen I a2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen I a2.
Laminin beta 1 (LAMB1) Rabbit Polyclonal Antibody
TA314147

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal anti-LAMB1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human LAMB1.
Collagen I (COL1A2) Rabbit Polyclonal Antibody
AP06516PU-N

USD 465.00

3 Weeks

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.
Collagen V (COL5A1) (N-term) Rabbit Polyclonal Antibody
AP51017PU-N

USD 580.00

2 Weeks

Collagen V (COL5A1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 54-82 amino acids from the N-terminal region of human COL5A1
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306659

USD 570.00

2 Weeks

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA342814

USD 539.00

5 Days

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS