Antibodies

View as table Download

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDPN

PDPN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDPN

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Pdpn rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant Mouse soluble Podoplanin (Gly23-Leu141) derived from E. coli (Cat.-No AR31060PU-N)

Pdpn rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant Mouse soluble Podoplanin (Gly23-Leu141) derived from E. coli (Cat.-No AR31060PU-N)

Goat Anti-PDPN Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKVDGDTQTTVEKD, from the internal region of the protein sequence according to NP_006465.3; NP_938203.2; NP_001006625.1; NP_001006626.1.

Podoplanin Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human Podoplanin
Modifications Unmodified

Podoplanin Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Podoplanin

Rabbit Polyclonal Anti-PDPN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM

Podoplanin Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Podoplanin