Antibodies

Jump to Filters
View as table Download
Estrogen induced gene 121 protein (KIAA1324) Rabbit Polyclonal Antibody
TA326613

USD 570.00

5 Days

Rabbit Polyclonal EIG121 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121.
Estrogen induced gene 121 protein (KIAA1324) Rabbit Polyclonal Antibody
TA338437

USD 539.00

5 Days

Rabbit Polyclonal Anti-KIAA1324 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA1324 antibody: synthetic peptide directed towards the N terminal of human KIAA1324. Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW