Rabbit Polyclonal EIG121 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121. |
Rabbit Polyclonal EIG121 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | EIG121 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human EIG121. |
Rabbit Polyclonal Anti-KIAA1324 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIAA1324 antibody: synthetic peptide directed towards the N terminal of human KIAA1324. Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW |