Rabbit Polyclonal Anti-EIF4B Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV |
Rabbit Polyclonal Anti-eIF4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-eIF4B Antibody: A synthesized peptide derived from human eIF4B |
Rabbit Polyclonal Anti-eIF4B (Phospho-Ser422) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-eIF4B (Phospho-Ser422) Antibody: A synthesized peptide derived from human eIF4B (Phospho-Ser422) |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China