Antibodies

Jump to Filters
View as table Download
NLRX1 Rabbit Polyclonal Antibody
TA320016

USD 570.00

In Stock

Rabbit Polyclonal NOD5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5.
NLRX1 Rabbit Polyclonal Antibody
TA337810

USD 539.00

5 Days

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
NLRX1 Rabbit Polyclonal Antibody
TA337985

USD 539.00

5 Days

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLRX1. Synthetic peptide located within the following region: SEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQL