Anti-COX6B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-COX6B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-COX6B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine, Rhesus Monkey, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854) |
Rabbit Polyclonal Anti-COX6B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-COX6B1 antibody is: synthetic peptide directed towards the N-terminal region of Human COX6B1. Synthetic peptide located within the following region: TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS |