Antibodies

View as table Download

Rabbit anti-RPA2 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPA2

Rabbit polyclonal anti-RFC2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RFC2

Rabbit Polyclonal anti-RFC3 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RFC3

Rabbit polyclonal anti-MLH1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MLH1.

Rabbit polyclonal anti-RFC2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RFC2.

Rabbit polyclonal anti-POLD1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD1.

Goat Anti-LIG1 / DNA ligase I Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1.

Rabbit polyclonal anti-POLD3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLD3.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

Rabbit polyclonal POLD2 Antibody (Center)

Applications WB
Reactivities Human, Rat (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2.

Rabbit polyclonal Anti-Rfc1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG

Rabbit Polyclonal Anti-PCNA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA

Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A).
Modifications Phospho-specific