Goat Anti-A4GNT / alpha4GNT Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTYRDLIKGPEGS, from the C Terminus of the protein sequence according to NP_057245.1. |
Rabbit polyclonal anti-A4GNT antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human A4GNT. |
Rabbit Polyclonal Anti-A4GNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME |
Rabbit Polyclonal Anti-A4GNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
Germany
Japan
United Kingdom
China