Rabbit Polyclonal Anti-TGFBI Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFBI antibody: synthetic peptide directed towards the C terminal of human TGFBI. Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA |
Rabbit anti-TGFBI Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGFBI |
TGFBI (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 105-135 amino acids from the N-terminal region of human TGFBI |
Goat Anti-TGFBI, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Peptide with sequence C-QLYTDRTEKLRPE., from the internal region of the protein sequence according to NP_000349.1. |
Germany
Japan
United Kingdom
China
