Antibodies

View as table Download

MMP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Horse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1

Anti-MMP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-200 amino acids of human matrix metallopeptidase 1 (interstitial collagenase)

Rabbit Polyclonal Anti-OLR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human OLR1

Rabbit Polyclonal Anti-APOA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Rabbit Polyclonal Antibody against PLTP

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A partial peptide of human PLTP.

Angiopoietin like 4 (ANGPTL4) (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 145~175 amino acids from the Center region of human ANGPTL4

Chicken Polyclonal ApoA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1.

Rabbit polyclonal MMP1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1.

Rabbit anti-ANGPTL4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANGPTL4

Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal anti-MMP-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-1 antibody.

Rabbit anti MMP-1 (Collagenase-I) Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to N-term of human MMP-1.

MMP1 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MMP1

PLTP rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 473 of Human PLTP

Rabbit polyclonal anti-APOA5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APOA5.