Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-OLR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human oxidized low density lipoprotein (lectin-like) receptor 1 |
Rabbit Polyclonal Anti-APOA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Rabbit polyclonal MMP1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1 |
Rabbit polyclonal anti-MMP-1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
PLTP rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 473 of Human PLTP |
Rabbit polyclonal anti-APOA5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOA5. |
Rabbit polyclonal MMP1 (Cleaved-Phe100) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Anti-ADIPOQ Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 230-244 amino acids of Human adiponectin, C1Q and collagen domain containing |
Rabbit Polyclonal Anti-MMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP1 Antibody: A synthesized peptide derived from human MMP1 |
Active filters
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Secreted Protein
Pathways
- PPAR signaling pathway