Germany
Japan
United Kingdom
China
Rabbit Polyclonal Fyn Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Fyn |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KYNU Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FYN |
c Abl (ABL1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Abl Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Abl |
FYN rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal c-Abl Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Abl |
Rabbit polyclonal Anti-FYN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FYN antibody: synthetic peptide directed towards the middle region of human FYN. Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN |
Rabbit polyclonal ABL1 (Thr735) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ABL1 around the phosphorylation site of threonine 735 (S-V-TP-L-P). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Applications
- WB
Clonalities
- Polyclonal
Families
- Protein Kinase
Pathways
- Viral myocarditis