Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TRPV1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRPV1 |
Antibodies
View as table Download
Anti-TRPM5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Rabbit Polyclonal Anti-TRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Anti-TRPC3 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 834-846 amino acids of human transient receptor potential cation channel, subfamily C, member 3 |
Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit polyclonal TRPC5 Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This TRPC5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-283 amino acids from the N-terminal region of human TRPC5. |
Rabbit Polyclonal Anti-TRPC3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPC3 antibody: synthetic peptide directed towards the n terminal of human TRPC3. Synthetic peptide located within the following region: MEGSPSLRRMTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYG |
Goat Polyclonal Antibody against TRPM7
| Applications | WB |
| Reactivities | Mouse, Rat, Human, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2. |
Goat Polyclonal Antibody against TRPV5
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SHRGWEILRQNT, from the internal region of the protein sequence according to NP_062815.2. |
Goat Anti-Polycystin 2 / PKD2 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERAKLKRREVLGR, from the internal region of the protein sequence according to NP_000288.1. |
Goat Anti-TRPC4 Antibody
| Applications | WB |
| Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHAKEEDSSIDYD, from the internal region (near C-Terminus) of the protein sequence according to NP_057263.1. |
Rabbit Polyclonal Anti-TRPC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TRPC3 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TRPC3. |
Rabbit polyclonal anti-TRPV1 Antibody, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Recombinant protein of human TRPV1 |
Rabbit polyclonal anti-TRPV1 Antibody, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
| Immunogen | Recombinant protein of human TRPV1 |
Rabbit polyclonal anti-TRPV1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TRPV1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Ion Channels: Transient receptor potential