Antibodies

View as table Download

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Goat Anti-PAX4 Antibody

Applications ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKLATATSLPEDTVR, from the internal region of the protein sequence according to NP_006184.2.

PAX4 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center).

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK