Rabbit Polyclonal Anti-FH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FH |
Rabbit Polyclonal Anti-FH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FH |
Rabbit Polyclonal Anti-DLAT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
Rabbit polyclonal anti-PDHA1 antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDHA1. |
Rabbit polyclonal PC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PC. |
Rabbit anti-PDHA1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDHA1 |
Rabbit Polyclonal Anti-PC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL |
Goat Anti-ACO1 / Aconitase 1 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVDFNRRADSLQKNQ, from the internal region of the protein sequence according to NP_002188.1. |
Rabbit polyclonal IREB1 / ACO1 (Ser711) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IREB1 around the phosphorylation site of serine 711 (Y-G-SP-R-R). |
Modifications | Phospho-specific |
Rabbit anti-FH Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FH |
Anti-ACO1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 132-146 amino acids of human aconitase 1, soluble |
Rabbit anti-DLD Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DLD |
Rabbit Polyclonal Anti-PDHA1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP |
Rabbit Polyclonal Anti-MDH2 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MDH2 antibody: synthetic peptide directed towards the C terminal of human MDH2. Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK |
Goat Polyclonal Anti-MDH1 / MOR2 (aa211-223) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MDH1 / MOR2 (aa211-223) Antibody: Peptide with sequence C-PDVNHAKVKLQGK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |
Goat Polyclonal Anti-MDH1 / MOR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MDH1 / MOR2 Antibody: Peptide with sequence TNCLTASKSAPSIPK, from the internal region of the protein sequence according to NP_001186040.1; NP_005908.1; NP_001186041.1. |