Antibodies

Jump to Filters
View as table Download
DDX6 (Center) Rabbit Polyclonal Antibody
AP51226PU-N

USD 580.00

2 Weeks

DDX6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 354~384 amino acids from the Central region of Human DDX6.
DDX6 Goat Polyclonal Antibody
TA302462

USD 520.00

In Stock

Goat Polyclonal Antibody against DEAD-box protein 6

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1.
DDX6 Rabbit Polyclonal Antibody
TA341566

USD 539.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL
DDX6 Rabbit Polyclonal Antibody
TA341567

USD 485.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ