Antibodies

View as table Download

Rabbit polyclonal C1GALT1 Antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This C1GALT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-144 amino acids from the Central region of human C1GALT1.

Rabbit Polyclonal Anti-C1GALT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1GALT1 antibody: synthetic peptide directed towards the middle region of human C1GALT1. Synthetic peptide located within the following region: NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC