Antibodies

Jump to Filters
View as table Download
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA336225

USD 539.00

5 Days

Rabbit Polyclonal Anti-GSR Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA323576

USD 380.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase
Glutathione Reductase (GSR) Rabbit Polyclonal Antibody
TA323577

USD 380.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase
Glutathione Reductase (GSR) (C-term) Rabbit Polyclonal Antibody
AP51963PU-N

USD 580.00

2 Weeks

Glutathione Reductase (GSR) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 387-416 amino acids from the C-terminal region of human Glutathione reductase.