Antibodies

Jump to Filters
View as table Download
CRLF2 Rabbit Polyclonal Antibody
TA351093

USD 380.00

In Stock

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRLF2
Crlf2 Rabbit Polyclonal Antibody
TA306426

USD 570.00

5 Days

Rabbit Polyclonal TSLP Receptor Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TSLP Receptor antibody was raised against a 19 amino acid peptide from near the center of human TSLP receptor.
Crlf2 Rabbit Polyclonal Antibody
TA306427

USD 570.00

5 Days

Rabbit Polyclonal TSLP Receptor Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen TSLP receptor antibody was raised against a 21 amino acid peptide from near the center of mouse TSLP receptor.
CRLF2 Rabbit Polyclonal Antibody
TA336112

USD 539.00

5 Days

Rabbit Polyclonal Anti-CRLF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
CRLF2 Rabbit Polyclonal Antibody
TA375103

USD 365.00

3 Weeks

CRLF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-231 of human CRLF2 (NP_071431.2).
Modifications Unmodified