Antibodies

Download

Rabbit Polyclonal PON1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390)

Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)

Applications WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12)

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit polyclonal anti-iNOS antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human iNOS.

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Anti-COX11 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 115-276 amino acids of human cytochrome c oxidase assembly homolog 11 (yeast)

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Rabbit Polyclonal Antibody against MAT2 alpha

Applications ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153]

Rabbit polyclonal ALPL Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL.

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit Polyclonal Anti-PCK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS