Antibodies

View as table Download

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse (Predicted: Bovine, Monkey)
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO1

Rabbit Polyclonal Anti-DCP1A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DCP1A

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Chicken, Monkey, Xenopus)
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit polyclonal CNOT8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8.

Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733)

Rabbit polyclonal CAF-1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Xenopus)
Conjugation Unconjugated
Immunogen This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1.

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK

DCP1A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 102-150 of Human SMIF.

CNOT4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAPOLA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 414-443 amino acids from the Central region of human PAPOLA

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO1 antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Rabbit Polyclonal CNOT4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Xenopus
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human CNOT4 was used as the immunogen for the antibody.