Rabbit polyclonal antibody to Amphiphysin (amphiphysin)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418) |
Rabbit Polyclonal Anti-GSN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
Rabbit polyclonal AMPH antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPH. |
Rabbit anti-AMPH Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AMPH |
Goat Polyclonal Antibody against Amphiphysin / AMPH
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRKDESRISKAE, from the internal region of the protein sequence according to NP_001626.1; NP_647477.1. |
Goat Polyclonal Antibody against GSN
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1. |
GSN Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GSN |
AMPH Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH |
Germany
Japan
United Kingdom
China
