Rabbit polyclonal SOX4 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 86-114 amino acids from the N-terminal region of human SOX4. |
Rabbit Polyclonal Anti-SOX4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX4 Antibody: synthetic peptide directed towards the N terminal of human SOX4. Synthetic peptide located within the following region: MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPS |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-FOXA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the middle region of human FOXA2. Synthetic peptide located within the following region: ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALS |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal KLF4 Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 394-421 amino acids from the C-terminal region of human KLF4. |
Rabbit polyclonal KLF4 Antibody
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 481-504 amino acids from human KLF4. |
Germany
Japan
United Kingdom
China
