Antibodies

Jump to Filters
View as table Download
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA351829

USD 380.00

In Stock

Rabbit Polyclonal Anti-TNFSF15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA314995

USD 380.00

In Stock

Rabbit polyclonal anti-TNFSF15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15.
TL1A (TNFSF15) Rabbit Polyclonal Antibody
TA329162

USD 539.00

5 Days

Rabbit Polyclonal anti-TNFSF15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP