ABCD1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ABCD1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Mouse Monoclonal ABCG2/CD338 Antibody (3G8)
Applications | ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
ABCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCD1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Carrier-free (BSA/glycerol-free) ABCD1 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal MRP1 Antibody (IU5C1)
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Chicken, Rat) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
Goat Polyclonal Antibody against ABCC8
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit anti-ABCD3 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCD3. |