Antibodies

Jump to Filters
View as table Download
HSP27 (HSPB1) Rabbit Polyclonal Antibody
TA301439

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Crystallin AB

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human Crystallin AB protein (within residues 100-175). [Swiss-Prot P02511]
VEGF Receptor 2 (KDR) Rabbit Polyclonal Antibody
TA311979

USD 380.00

4 Weeks

Rabbit polyclonal KDR / VEGFR2 (Tyr1214) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human VEGFR2 around the phosphorylation site of tyrosine 1214 (F-H-YP-D-N).
Modifications Phospho-specific
RAF1 pSer621 Mouse Monoclonal Antibody [Clone ID: 6B4]
AM00131PU-N

USD 590.00

2 Weeks

RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
SH2D2A Mouse Monoclonal Antibody [Clone ID: OTI1B8]
TA504381S

USD 200.00

2 Days

SH2D2A mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
AKT1 Mouse Monoclonal Antibody [Clone ID: 960CT4.5.1]
TA325176

USD 580.00

5 Days

Mouse monoclonal AKT1 Antibody(Ascites)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA330913

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK