Antibodies

View as table Download

Goat Anti-C9 (aa205-216) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETKGEKNFRTEH, from the internal region of the protein sequence according to NP_001728.1.

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH

Complement C5 (C5) mouse monoclonal antibody, clone HCC5.1, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal HLA-DQB1 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1.

Rabbit Polyclonal Anti-H2AFB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-H2AFB1 Antibody is: synthetic peptide directed towards the N-terminal region of Human H2AFB1. Synthetic peptide located within the following region: SSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAV

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS