Anti-ALDH3B1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Anti-ALDH3B1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Rabbit polyclonal GOT2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey) |
Conjugation | Unconjugated |
Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit anti-ALDH3A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH3A1 |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA |