Antibodies

View as table Download

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated

Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TP53 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TP53 mouse monoclonal antibody, clone DO-1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TA804804 is a replacement of SM2137P.

FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific