Antibodies

View as table Download

Rabbit anti-SIRT7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIRT7

Rabbit Polyclonal Anti-SIRT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SIRT1

Rabbit anti-MEF2C Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MEF2C

Rabbit Polyclonal Anti-p63 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p63 Antibody: A synthesized peptide derived from human p63

Goat Polyclonal Antibody against DACH1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence SPVENTPQNNECK, from the internal region of the protein sequence according to NP_542937.1; NP_542938.1; NP_004383.2.

Rabbit Polyclonal Anti-RUNX3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3. Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT

Rabbit Polyclonal Anti-NR4A3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NR4A3 Antibody: A synthesized peptide derived from human NR4A3

Rabbit Polyclonal Anti-AP-2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.

Rabbit Polyclonal Anti-XBP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-XBP1 Antibody: A synthesized peptide derived from human XBP1

Rabbit Polyclonal Anti-sod2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2

Rabbit Polyclonal Anti-53BP1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-53BP1 Antibody: A synthesized peptide derived from human 53BP1