Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
Rabbit anti-SIRT7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIRT7 |
Rabbit Polyclonal Anti-SIRT1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SIRT1 |
Rabbit anti-MEF2C Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MEF2C |
Rabbit Polyclonal Anti-p63 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p63 Antibody: A synthesized peptide derived from human p63 |
Goat Polyclonal Antibody against DACH1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SPVENTPQNNECK, from the internal region of the protein sequence according to NP_542937.1; NP_542938.1; NP_004383.2. |
Rabbit Polyclonal Anti-RUNX3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RUNX3 antibody: synthetic peptide directed towards the C terminal of mouse RUNX3. Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT |
Rabbit Polyclonal Anti-NR4A3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR4A3 Antibody: A synthesized peptide derived from human NR4A3 |
Rabbit Polyclonal Anti-AP-2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AP-2 Antibody: A synthesized peptide derived from human AP-2 |
Rabbit Polyclonal Anti-TGF beta1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
Rabbit Polyclonal Anti-XBP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XBP1 Antibody: A synthesized peptide derived from human XBP1 |
Rabbit Polyclonal Anti-sod2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2 |
Rabbit Polyclonal Anti-53BP1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-53BP1 Antibody: A synthesized peptide derived from human 53BP1 |