Antibodies

Jump to Filters
View as table Download
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325661

USD 380.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3
TGF beta Receptor II (TGFBR2) Rabbit Polyclonal Antibody
TA347477

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGFR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2
DAP Kinase 1 (DAPK1) Rabbit Polyclonal Antibody
TA344411

USD 539.00

Backordered

Rabbit Polyclonal Anti-DAPK1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAPK1 antibody: synthetic peptide directed towards the N terminal of human DAPK1. Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK
CD117 Goat Polyclonal Antibody
TA320207

USD 520.00

5 Days

Goat Polyclonal KIT/CD117 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence KRDSFICSKQEDH, from the internal region of the protein sequence according to NP_000213.1; NP_001087241.1
CD117 Rabbit Polyclonal Antibody
TA354556

USD 400.00

5 Days

Rabbit anti CD117 (kit) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998.