Antibodies

View as table Download

Anti-ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ARNTL (BMAL1) mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Unconjugated

ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ARNTL (BMAL1) mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ARNTL (BMAL1) mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-PER2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PER2 antibody: synthetic peptide directed towards the middle region of human PER2. Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ

Rabbit Polyclonal Antibody against BMAL

Applications ChIP, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human BMAL1