Antibodies

Jump to Filters
View as table Download
Factor H (CFH) Mouse Monoclonal Antibody [Clone ID: OTI5H5]
TA804532

USD 447.00

In Stock

Purified CFH mouse monoclonal antibody, clone OTI5H5 (formerly 5H5)

Applications WB
Reactivities Human
Conjugation Unconjugated
PLAUR Rabbit Polyclonal Antibody
TA323492

USD 380.00

2 Weeks

Anti-PLAUR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor
PLAT Rabbit Polyclonal Antibody
TA321237

USD 380.00

4 Weeks

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.
Von Willebrand Factor (VWF) Mouse Monoclonal Antibody [Clone ID: OTI1G1]
CF803259

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) VWF mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications WB
Reactivities Human
Conjugation Unconjugated
PAI1 (SERPINE1) Goat Polyclonal Antibody
TA303014

USD 520.00

5 Days

Goat Polyclonal Antibody against SERPINE1

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1.
Factor VIII (F8) Rabbit Polyclonal Antibody
TA325456

USD 380.00

4 Weeks

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
AP17235PU-N

USD 580.00

2 Weeks

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2
Plasminogen (PLG) Goat Polyclonal Antibody
TA319306

USD 1,795.00

5 Days

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS