Antibodies

View as table Download

Goat Polyclonal Anti-beta-Catenin Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human (Predicted: Mouse, Rat, Drosophila)
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications Phospho-specific

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780
Modifications Phospho-specific

Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730
Modifications Phospho-specific

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3