Antibodies

Jump to Filters
View as table Download
PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
TA500123

USD 478.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BMP4 Mouse Monoclonal Antibody [Clone ID: UMAB42]
UM500038

USD 564.00

In Stock

BMP4 mouse monoclonal antibody,clone UMAB42

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLI1 Mouse Monoclonal Antibody [Clone ID: UMAB170]
UM800063

USD 564.00

In Stock

GLI1 mouse monoclonal antibody,clone UMAB170

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTCH1 Mouse Monoclonal Antibody [Clone ID: OTI5C7]
TA500123S

USD 200.00

In Stock

Patched1 (Patched) mouse monoclonal antibody, clone OTI5C7 (formerly 5C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BMP4 Mouse Monoclonal Antibody [Clone ID: OTI6B7]
TA500014

USD 447.00

In Stock

Anti-BMP4 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GLI2 Mouse Monoclonal Antibody [Clone ID: OTI1G1]
TA804601

USD 447.00

In Stock

GLI2 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
BMP6 Rabbit Polyclonal Antibody
AP20577PU-N

USD 445.00

3 Weeks

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF803780

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
WNT5A Rabbit Polyclonal Antibody
TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody
TA313698

USD 380.00

2 Weeks

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT