Antibodies

Jump to Filters
View as table Download
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA332173

USD 485.00

In Stock

Rabbit Polyclonal Anti-JMJD1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JMJD1A Antibody: synthetic peptide directed towards the C terminal of human JMJD1A. Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY
KDM3A / JHDM2A (KDM3A) Rabbit Polyclonal Antibody
TA332511

USD 365.00

3 Weeks

Rabbit anti-KDM3A Polyclonal Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KDM3A