Antibodies

View as table Download

Rabbit Polyclonal Ipaf Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Ipaf antibody was raised against a synthetic peptide corresponding to amino acids near the C-terminus of human Ipaf.

Rabbit Polyclonal Anti-NLRC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRC4 antibody: synthetic peptide directed towards the C terminal of human NLRC4. Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV