Antibodies

Jump to Filters
View as table Download
SLC2A2 Rabbit Polyclonal Antibody
TA336933

USD 560.00

2 Weeks

Rabbit Polyclonal Glut2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLUT2 protein (between residues 50-150) [UniProt P11168]
SLC2A2 Rabbit Polyclonal Antibody
TA346176

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC2A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC2A2 antibody: synthetic peptide directed towards the N terminal of human SLC2A2. Synthetic peptide located within the following region: ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST
Slc2a2 Rabbit Polyclonal Antibody
TA396527

USD 765.00

5 Days

Glut2 Antibody

Applications ELISA, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of mouse Glut2 protein.
Slc2a2 Rabbit Polyclonal Antibody
TA396527S

USD 285.00

5 Days

Glut2 Antibody

Applications ELISA, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of mouse Glut2 protein.
Slc2a2 Rabbit Polyclonal Antibody
TA397444

USD 765.00

5 Days

Glut2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of mouse Glut2 protein.
Slc2a2 Rabbit Polyclonal Antibody
TA397444S

USD 285.00

5 Days

Glut2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of mouse Glut2 protein.
SLC2A2 (N-term) Rabbit Polyclonal Antibody
AP11502PU-N

USD 580.00

2 Weeks

SLC2A2 (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SLC2A2.
SLC2A2 Rabbit Polyclonal Antibody
TA381632

USD 365.00

3 Weeks

GLUT2/SLC2A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT2/GLUT2/SLC2A2 (NP_000331.1).
Modifications Unmodified