Mouse Monoclonal DNMT1 Antibody (60B1220.1)
Applications | ChIP, CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Mouse Monoclonal DNMT1 Antibody (60B1220.1)
Applications | ChIP, CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
DNMT1 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT1. |
Modifications | Unmodified |
DNMT1 Rabbit polyclonal Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein of Human DNMT1. |
Modifications | Unmodified |
DNMT1 Rabbit polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human DNMT1 (NP_001370.1). |
Modifications | Unmodified |
Mouse monoclonal DNMT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Dnmt1 Rabbit monoclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal DNMT1 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein. |
DNMT1 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human DNMT1. |
Dnmt1 Rabbit polyclonal Antibody
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Dnmt1 |
DNMT1 (C-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Dnmt1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human Dnmt1. |
Goat Polyclonal Antibody against DNMT1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1. |
Mouse monoclonal DNMT1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Dnmt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1. Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR |
Dnmt1 Antibody - Middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the Middle region of Human Dnmt1 |