Mouse Monoclonal PGRP1A Antibody (187C434)
Applications | FC, ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal PGRP1A Antibody (187C434)
Applications | FC, ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PGLYRP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PGLYRP3 antibody is: synthetic peptide directed towards the N-terminal region of Human PGLYRP3. Synthetic peptide located within the following region: SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQG |