Antibodies

View as table Download

Rabbit polyclonal EMX1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EMX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-257 amino acids from the C-terminal region of human EMX1.

Rabbit polyclonal anti-EMX1 antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EMX1.

Chicken Polyclonal EMX1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EMX1 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human EMX1.

Rabbit Polyclonal Anti-EMX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1. Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL

Rabbit Polyclonal Anti-EMX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1. Synthetic peptide located within the following region: DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSL