PLCD1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 154-184 amino acids from the N-terminal region of human PLCD1 |
PLCD1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 154-184 amino acids from the N-terminal region of human PLCD1 |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ |
Rabbit Polyclonal Anti-PLCD1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLCD1 antibody: synthetic peptide directed towards the N terminal of human PLCD1. Synthetic peptide located within the following region: DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH |