Antibodies

View as table Download

liver FABP (FABP1) mouse monoclonal antibody, clone 2G4, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

liver FABP (FABP1) mouse monoclonal antibody, clone 2G4, Purified

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-FABP1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FABP1

Rabbit Polyclonal Anti-FABP1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP1

liver FABP (FABP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of human FABP1

Rabbit Polyclonal Anti-FABP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP1 antibody: synthetic peptide directed towards the N terminal of human FABP1. Synthetic peptide located within the following region: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF