NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 565.00
2 Weeks
Neuropeptide Y (NPY) (29-97) mouse monoclonal antibody, clone 2C10, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NPY Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP |
Anti-NPY Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".