Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to ORC2 (origin recognition complex, subunit 2-like (yeast))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 208 and 479 of ORC2 (Uniprot ID#Q13416) |
Rabbit polyclonal ORC2L Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ORC2L antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 208-237 amino acids from the Central region of human ORC2L. |
Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV |
ORC2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ORC2 |
ORC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 458-577 of human ORC2 (NP_006181.1). |
| Modifications | Unmodified |
