Antibodies

View as table Download

Cyclin A1/A2 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Cyclin A1/A2

Rabbit Polyclonal anti-Ccna2 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET

Cyclin A2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Cyclin A2 (NP_001228.1).
Modifications Unmodified