Antibodies

Jump to Filters
View as table Download
BCL2A1 Rabbit Polyclonal Antibody
TA323788

USD 380.00

4 Weeks

Anti-BCL2A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1
BCL2A1 Rabbit Polyclonal Antibody
TA330408

USD 539.00

5 Days

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY