Germany
Japan
United Kingdom
China
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Antibodies
View as table Download
Rabbit polyclonal NeuroD1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1. |
Rabbit polyclonal HNF4A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Rabbit Polyclonal Anti-FOXA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the middle region of human FOXA2. Synthetic peptide located within the following region: ASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALS |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613) |
Rabbit Polyclonal Anti-HNF1A
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Goat Polyclonal Antibody against HNF4A
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1. |
Anti-IAPP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-52 amino acids of Human Islet amyloid polypeptide |
Rabbit polyclonal GCK Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK. |
Rabbit polyclonal HNF1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against FOXA2
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Isotypes
- IgG
Pathways
- Maturity onset diabetes of the young