SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SEC11A mouse monoclonal antibody,clone OTI1A12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SEC11A mouse monoclonal antibody,clone OTI1A12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
SEC11A mouse monoclonal antibody,clone OTI1A11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SEC11A mouse monoclonal antibody,clone OTI1A11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SEC11A mouse monoclonal antibody,clone OTI1A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OXA1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OXA1L antibody is: synthetic peptide directed towards the C-terminal region of Human OXA1L. Synthetic peptide located within the following region: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS |
SEC11A mouse monoclonal antibody,clone OTI1A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |