Antibodies

View as table Download

Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

CPT1B mouse monoclonal antibody,clone OTI2A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI2A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CPT1B mouse monoclonal antibody,clone OTI2A6, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

CPT1B mouse monoclonal antibody,clone OTI2A6, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against GLUT1

Applications ChIP, FC, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated