Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CPT1B mouse monoclonal antibody,clone OTI2A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPT1B mouse monoclonal antibody,clone OTI2A6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CPT1B mouse monoclonal antibody,clone OTI2A6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
CPT1B mouse monoclonal antibody,clone OTI2A6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GLUT1
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 236.00
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR4H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 236.00
USD 471.00
In Stock
G6PC Rabbit monoclonal antibody,clone OTIR5G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |